-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 13 (KRT13) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 13 (KRT13) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00294A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 13 (KRT13) |
| Target Synonyms | K13; CK13; WSN2; Cytokeratin 13 (KRT13) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP | Uniprot ID | P13646 |
Uniprot Id
P13646
Target Species
Human
Target Name
KRT13
Target Full Name
Keratin, type I cytoskeletal 13
Target Involvement
White sponge nevus 2 (WSN2)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in some epidermal sweat gland ducts (at protein level) and in exocervix, esophagus and placenta.
Target Synonyms
47 kDa cytokeratin; CK-13; CK13; Cytokeratin 13; Cytokeratin-13; K13; K1C13_HUMAN; Ka13; Keratin 13; Keratin; keratin type I cytoskeletal 13 ; Keratin-13; Krt-1.13; Krt1-13; KRT13; MGC161462; MGC3781; type I cytoskeletal 13; Type I keratin Ka13; WSN2
Target Background
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described.
Notification