Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human BTG3 (NP_006797.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human BTG3 (NP_006797.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00508A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTG3 |
| Target Synonyms | ANA; TOB5; TOFA; APRO4; TOB55; ANA/BTG3; BTG3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human BTG3 (NP_006797.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLA | Uniprot ID | Q14201 |
Uniprot Id
Q14201
Target Species
Human
Target Name
BTG3
Target Full Name
Protein BTG3
Target Function
Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
Target Protein Families
BTG family
Target Tissue Specificity
Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung.
Target Synonyms
Abundant in neuroepithelium area protein; ANA; BTG family member 3; Btg3; BTG3_HUMAN; Protein BTG3; Protein Tob5
Target Background
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
