Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTGIR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human PTGIR (NP_000951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PTGIR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human PTGIR (NP_000951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTGIR |
| Target Synonyms | IP; PRIPR; PTGIR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human PTGIR (NP_000951.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLSLCRMYRQQKRHQGSLGPRPRTGEDEVDHLILLALMTVVMAVCSLPLTIRCFTQAVAPDSSSEMGDLLAFRFYAFNPILDPWVFILFRKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC | Uniprot ID | P43119 |
Uniprot Id
P43119
Target Species
Human
Target Name
PTGIR
Target Full Name
Prostacyclin receptor
Target Function
Receptor for prostacyclin (prostaglandin I2 or PGI2). The activity of this receptor is mediated by G(s) proteins which activate adenylate cyclase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
PTGIR; PRIPR; Prostacyclin receptor; Prostaglandin I2 receptor; PGI receptor; PGI2 receptor; Prostanoid IP receptor
Target Background
The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
