-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SS18L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-270 of human SS18L1 (NP_945173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SS18L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-270 of human SS18L1 (NP_945173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01095A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SS18L1 |
| Target Synonyms | CREST; LP2261; SMARCL2; SS18L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-29, Mouse brain, Mouse liver, Raji, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-270 of human SS18L1 (NP_945173.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTQSGSSQGLHSQGSLSDAISTGLPPSSLLQGQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQGVPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSSAQGGSQHYQGQSSIAMMGQGSQGSSMMGQRPMAPYRPSQQGSSQQYLGQEEYYGEQYSHSQGAAEPMGQQ | Uniprot ID | O75177 |
Uniprot Id
O75177
Target Species
Human
Target Name
SS18L1
Target Full Name
Calcium-responsive transactivator
Target Function
Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore.
Target Protein Families
SS18 family
Target Tissue Specificity
Ubiquitous; with lowest levels in spleen.
Target Synonyms
Calcium-responsive transactivator; CREST; CREST_HUMAN; KIAA0693; LP2261; MGC26711; MGC78386; sarcoma translocation gene on chromosome18like1; SS18; SS18-like protein 1; SS18L1; SS18L1 nBAF chromatin remodeling complex; SSXT; synovial sarcoma translocation; synovial sarcoma translocation gene on chromosome 18-like 1; SYT homolog 1
Target Background
This gene encodes a calcium-responsive transactivator which is an essential subunit of a neuron-specific chromatin-remodeling complex. The structure of this gene is similar to that of the SS18 gene. Mutations in this gene are involved in amyotrophic lateral sclerosis (ALS). Alternatively spliced transcript variants have been found for this gene.
Notification