-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCN1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN1B |
| Target Synonyms | DEE52; ATFB13; BRGDA5; EIEE52; GEFSP1; SCN1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, MCF7, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKGESGAACPFTV | Uniprot ID | Q07699 |
Uniprot Id
Q07699
Target Species
Human
Target Name
SCN1B
Target Full Name
Sodium channel regulatory subunit beta-1
Target Function
Regulatory subunit of multiple voltage-gated sodium channel complexes that play important roles in excitable membranes in brain, heart and skeletal muscle. Enhances the presence of the pore-forming alpha subunit at the cell surface and modulates channel gating characteristics and the rate of channel inactivation. Modulates the activity of multiple pore-forming alpha subunits, such as SCN1A, SCN2A, SCN3A, SCN4A, SCN5A and SCN10A.; Cell adhesion molecule that plays a critical role in neuronal migration and pathfinding during brain development. Stimulates neurite outgrowth. Has no regulatory function on the SCN2A sodium channel complex.
Target Involvement
Generalized epilepsy with febrile seizures plus 1 (GEFS+1); Brugada syndrome 5 (BRGDA5); Atrial fibrillation, familial, 13 (ATFB13); Epileptic encephalopathy, early infantile, 52 (EIEE52)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Perikaryon. Cell projection. Cell projection, axon.; [Isoform 2]: Perikaryon. Cell projection. Secreted.
Target Protein Families
Sodium channel auxiliary subunit SCN1B (TC 8.A.17) family
Target Tissue Specificity
The overall expression of isoform 1 and isoform 2 is very similar. Isoform 1 is abundantly expressed in skeletal muscle, heart and brain. Isoform 2 is highly expressed in brain and skeletal muscle and present at a very low level in heart, placenta, lung,
Target Synonyms
DEE52; ATFB13; BRGDA5; EIEE52; GEFSP1; SCN1B
Target Background
Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activity and the beta-1 subunit modulates the kinetics of channel inactivation. This gene encodes a sodium channel beta-1 subunit. Mutations in this gene result in generalized epilepsy with febrile seizures plus, Brugada syndrome 5, and defects in cardiac conduction. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification