Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMEK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 395-594 of human SMEK1 (NP_001271210.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SMEK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 395-594 of human SMEK1 (NP_001271210.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01244A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMEK1 |
| Target Synonyms | smk1; FLFL1; PP4R3; SMEK1; smk-1; PP4R3A; MSTP033; KIAA2010 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, Jurkat, MCF-7, Mouse spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 395-594 of human SMEK1 (NP_001271210.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS | Uniprot ID | Q6IN85 |
Uniprot Id
Q6IN85
Target Species
Human
Target Name
PPP4R3A
Target Full Name
Serine/threonine-protein phosphatase 4 regulatory subunit 3A
Target Function
Regulatory subunit of serine/threonine-protein phosphatase 4. May regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AX phosphorylated on 'Ser-140' (gamma-H2AX) generated during DNA replication and required for DNA DSB repair.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Note=In interphase localized in the cytoplasm and in the nucleus (with higher levels). During metaphase located in pericentriolar regions.
Target Protein Families
SMEK family
Target Synonyms
FLFL1; KIAA2010; MEK1 SUPPRESSOR 1; MSTP033; P4R3A_HUMAN; PP4R3 ALPHA; PP4R3; PP4R3A; PPP4R3A; Protein phosphatase 4 regulatory subunit 3A; PROTEIN PHOSPHATASE 4, REGULATORY SUBUNIT 3, ALPHA; Serine/threonine-protein phosphatase 4 regulatory subunit 3A; SMEK homolog 1; SMEK homolog 1, suppressor of mek1 (Dictyostelium); smek1; Smk 1; SMK1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
