Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC23A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 512-598 of human SLC23A1 (NP_005838.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC23A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 512-598 of human SLC23A1 (NP_005838.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01373A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC23A1 |
| Target Synonyms | SVCT1; YSPL3; SLC23A2; SLC23A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, LO2, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 512-598 of human SLC23A1 (NP_005838.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV | Uniprot ID | Q9UHI7 |
Uniprot Id
Q9UHI7
Target Species
Human
Target Name
SLC23A1
Target Full Name
Solute carrier family 23 member 1
Target Function
Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Xanthine/uracil permease family, Nucleobase:cation symporter-2 (NCS2) (TC 2.A.40) subfamily
Target Tissue Specificity
Highly expressed in adult small intestine, kidney, thymus, ovary, colon, prostate and liver, and in fetal kidney, liver and thymus.
Target Synonyms
hSVCT1; Na(+)/L-ascorbic acid transporter 1; S23A1_HUMAN; Slc23a1; Sodium-dependent vitamin C transporter 1; solute carrier family 23 (nucleobase transporters); member 1; Solute carrier family 23 member 1; SVCT1; Yolk sac permease-like molecule 3; YSPL3
Target Background
The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two transporters. The encoded protein is active in bulk vitamin C transport involving epithelial surfaces. Previously, this gene had an official symbol of SLC23A2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
