Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REEP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against REEP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01472A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REEP5 |
| Target Synonyms | DP1; TB2; YOP1; POB16; Yip2e; D5S346; C5orf18; REEP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, A375, LO2, MCF7, Mouse brain, Mouse pancreas, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST | Uniprot ID | Q00765 |
Uniprot Id
Q00765
Target Species
Human
Target Name
REEP5
Target Full Name
Receptor expression-enhancing protein 5
Target Function
May promote functional cell surface expression of olfactory receptors.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Target Protein Families
DP1 family
Target Tissue Specificity
Expressed in circumvallate papillae and testis.
Target Synonyms
DP1; TB2; YOP1; POB16; Yip2e; D5S346; C5orf18; REEP5
Target Background
Predicted to be involved in endoplasmic reticulum organization and regulation of intracellular transport. Located in endoplasmic reticulum tubular network.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
