-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RIC8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RIC8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01473A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RIC8A |
| Target Synonyms | RIC8; RIC8A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, DU145, HepG2, Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD | Uniprot ID | Q9NPQ8 |
Uniprot Id
Q9NPQ8
Target Species
Human
Target Name
RIC8A
Target Full Name
Chaperone Ric-8A
Target Function
Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins. Able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
Synembryn family
Target Synonyms
MGC104517; MGC131931; MGC148073; MGC148074; Protein Ric-8A; resistance to inhibitors of cholinesterase 8 homolog A (C. elegans); RIC8; RIC8A; RIC8A_HUMAN; Synembryn-A
Target Background
Predicted to enable G-protein alpha-subunit binding activity; GTPase activator activity; and guanyl-nucleotide exchange factor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to act upstream of or within several processes, including basement membrane organization; gastrulation; and visual learning. Predicted to be located in membrane. Predicted to be active in cytoplasm and plasma membrane.
Notification