Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRLHR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRLHR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01557A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRLHR |
| Target Synonyms | GR3; GPR10; PrRPR; PRLHR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRLHR (NP_004239.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV | Uniprot ID | P49683 |
Uniprot Id
P49683
Target Species
Human
Target Name
PRLHR
Target Full Name
Prolactin-releasing peptide receptor
Target Function
Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Only detected in the pituitary gland and in all cell types of pituitary adenomas.
Target Synonyms
PRLHR; GPR10; GR3; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10; hGR3
Target Background
Predicted to enable neuropeptide receptor activity. Predicted to be involved in female pregnancy. Predicted to act upstream of or within G protein-coupled receptor signaling pathway; feeding behavior; and hormone metabolic process. Located in cilium. Implicated in hypertension.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
