-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL36RN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of human IL36RN (NP_036407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL36RN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of human IL36RN (NP_036407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01592A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL36RN |
| Target Synonyms | FIL1; FIL1D; IL1F5; IL1L1; PSORP; IL1HY1; IL1RP3; IL36RA; IL-36Ra; PSORS14; FIL1(DELTA); IL36RN | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of human IL36RN (NP_036407.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD | Uniprot ID | Q9UBH0 |
Uniprot Id
Q9UBH0
Target Species
Human
Target Name
IL36RN
Target Full Name
Interleukin-36 receptor antagonist protein
Target Function
Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Target Involvement
Psoriasis 14, pustular (PSORS14)
Target Subcellular Location
Cytoplasm. Secreted.
Target Protein Families
IL-1 family
Target Tissue Specificity
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Target Research Area
Immunology
Target Synonyms
AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog, IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6
Target Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.
Notification