-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CST7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CST7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01758A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CST7 |
| Target Synonyms | CMAP; CST7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human CST7 (NP_003641.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH | Uniprot ID | O76096 |
Uniprot Id
O76096
Target Species
Human
Target Name
CST7
Target Full Name
Cystatin-F
Target Function
Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
Target Subcellular Location
Secreted. Cytoplasm.
Target Protein Families
Cystatin family
Target Tissue Specificity
Primarily expressed in peripheral blood cells and spleen.
Target Synonyms
CMAP; CST 7; Cst7; Cystatin 7; cystatin F (leukocystatin); Cystatin like metastasis associated protein; Cystatin-7; Cystatin-F; Cystatin-like metastasis-associated protein; Cystatin7; CystatinF; CYTF_HUMAN; dJ568C11.1; Leukocystatin
Target Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors.
Notification