Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against B9D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human B9D1 (NP_056496.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against B9D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human B9D1 (NP_056496.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01838A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | B9D1 |
| Target Synonyms | B9; MKS9; EPPB9; MKSR1; JBTS27; MKSR-1; B9D1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse lung, Mouse ovary, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human B9D1 (NP_056496.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKL | Uniprot ID | Q9UPM9 |
Uniprot Id
Q9UPM9
Target Species
Human
Target Name
B9D1
Target Full Name
B9 domain-containing protein 1
Target Function
Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.
Target Involvement
Meckel syndrome 9 (MKS9); Joubert syndrome 27 (JBTS27)
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, cilium axoneme.
Target Protein Families
B9D family
Target Synonyms
B9D1; MKSR1B9 domain-containing protein 1; MKS1-related protein 1
Target Background
This gene encodes a B9 domain-containing protein, one of several that are involved in ciliogenesis. Alterations in expression of this gene have been found in a family with Meckel syndrome. Meckel syndrome has been associated with at least six different genes. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
