-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARPC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human ARPC3 (NP_001265485.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARPC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human ARPC3 (NP_001265485.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01955A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARPC3 |
| Target Synonyms | ARC21; p21-Arc; ARPC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Mouse spleen, Rat ovary, SH-SY5Y, SKOV3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human ARPC3 (NP_001265485.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ | Uniprot ID | O15145 |
Uniprot Id
O15145
Target Species
Human
Target Name
ARPC3
Target Full Name
Actin-related protein 2/3 complex subunit 3
Target Function
Component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs).
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection. Nucleus.
Target Protein Families
ARPC3 family
Target Research Area
Signal Transduction
Target Synonyms
ARPC3; ARC21Actin-related protein 2/3 complex subunit 3; Arp2/3 complex 21 kDa subunit; p21-ARC
Target Background
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene.
Notification