-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC3 (NP_001124170.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC3 (NP_001124170.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPC3 |
| Target Synonyms | TRP3; SCA41; TRPC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, 293T, BT-474, Mouse brain, Rat spinal cord | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC3 (NP_001124170.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD | Uniprot ID | Q13507 |
Uniprot Id
Q13507
Target Species
Human
Target Name
TRPC3
Target Full Name
Short transient receptor potential channel 3
Target Function
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol 1,4,5-triphosphate receptors (ITPR) with bound IP3. May also be activated by internal calcium store depletion.
Target Involvement
Spinocerebellar ataxia 41 (SCA41)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC3 sub-subfamily
Target Tissue Specificity
Expressed predominantly in brain and at much lower levels in ovary, colon, small intestine, lung, prostate, placenta and testis.
Target Synonyms
TRPC3; TRP3; Short transient receptor potential channel 3; TrpC3; Transient receptor protein 3; TRP-3; hTrp-3; hTrp3
Target Background
The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.
Notification