-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LILRB2/CD85d/ILT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 479-598 of human LILRB2/CD85d/ILT4 (NP_005865.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LILRB2/CD85d/ILT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 479-598 of human LILRB2/CD85d/ILT4 (NP_005865.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02208A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LILRB2/CD85d/ILT4 |
| Target Synonyms | ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10; LILRB2/CD85d/ILT4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 479-598 of human LILRB2/CD85d/ILT4 (NP_005865.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH | Uniprot ID | Q8N423 |
Uniprot Id
Q8N423
Target Species
Human
Target Name
LILRB2
Target Full Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
Target Function
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles. Involved in the down-regulation of the immune response and the development of tolerance. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (peptide-bound HLA-G-B2M) triggering differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in monocytes and at lower levels in myeloid and plasmacytoid dendritic cells. Expressed in tolerogenic IL10-producing dendritic cells. Expressed in myeloid-derived suppressor cells during pregnancy. Detected at low levels in natural killer (NK)
Target Research Area
Immunology
Target Synonyms
CD85 antigen-like family member D; CD85d; CD85d antigen ; ILT 4; ILT-4; ILT4; Immunoglobulin like transcript 4; Immunoglobulin-like transcript 4; Leukocyte immunoglobulin like receptor 2; Leukocyte immunoglobulin like receptor subfamily B member 2; Leukocyte immunoglobulin-like receptor 2; Leukocyte immunoglobulin-like receptor subfamily B member 2; Leukocyte immunoglobulin-like receptor; subfamily B (with TM and ITIM domains); member 2; LILRA6; LILRB2; LIR 2; LIR-2; LIR2; LIRb; LIRB2_HUMAN; MIR 10; MIR-10; MIR10; Monocyte/macrophage immunoglobulin like receptor 10; Monocyte/macrophage immunoglobulin-like receptor 10
Target Background
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification