Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNPH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-425 of human SNPH (NP_055538.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNPH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-425 of human SNPH (NP_055538.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse small intestine, using SNPH Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
| Cat.No | ADA-02296A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNPH |
| Target Synonyms | SNPH; bA314N13.5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-425 of human SNPH (NP_055538.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRHY | Uniprot ID | O15079 |
Uniprot Id
O15079
Target Species
Human
Target Name
SNPH
Target Full Name
Syntaphilin
Target Function
Inhibits SNARE complex formation by absorbing free syntaxin-1.
Target Subcellular Location
Membrane; Single-pass membrane protein. Cell junction, synapse, synaptosome.
Target Tissue Specificity
Brain specific. Found in synapses.
Target Research Area
Neuroscience
Target Synonyms
bA314N13.5; KIAA0374; Snph; SNPH_HUMAN; Syntaphilin
Target Background
Syntaxin-1, synaptobrevin/VAMP, and SNAP25 interact to form the SNARE complex, which is required for synaptic vesicle docking and fusion. The protein encoded by this gene is membrane-associated and inhibits SNARE complex formation by binding free syntaxin-1. Expression of this gene appears to be brain-specific. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
