Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SHMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHMT1 |
| Target Synonyms | SHMT; CSHMT; SHMT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF | Uniprot ID | P34896 |
Uniprot Id
P34896
Target Species
Human
Target Name
SHMT1
Target Full Name
Serine hydroxymethyltransferase, cytosolic
Target Function
Interconversion of serine and glycine.
Target Subcellular Location
Cytoplasm.
Target Protein Families
SHMT family
Target Synonyms
CSHMT; Cytoplasmic serine hydroxymethyltransferase; cytosolic; GLYC_HUMAN; Glycine hydroxymethyltransferase; Serine hydroxymethyltransferase 1 (soluble); Serine hydroxymethyltransferase; Serine hydroxymethyltransferase; cytosolic; Serine methylase; SHMT; Shmt1
Target Background
This gene encodes the cytosolic form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5, 10-methylene tetrahydrofolate. This reaction provides one-carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. A pseudogene of this gene is located on the short arm of chromosome 1. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
