Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 429-598 of human CACNB1 (NP_000714.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CACNB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 429-598 of human CACNB1 (NP_000714.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNB1 |
| Target Synonyms | CAB1; CCHLB1; CACNLB1; CACNB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 429-598 of human CACNB1 (NP_000714.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR | Uniprot ID | Q02641 |
Uniprot Id
Q02641
Target Species
Human
Target Name
CACNB1
Target Full Name
Voltage-dependent L-type calcium channel subunit beta-1
Target Function
Regulatory subunit of L-type calcium channels. Regulates the activity of L-type calcium channels that contain CACNA1A as pore-forming subunit. Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit and increases the presence of the channel complex at the cell membrane. Required for functional expression L-type calcium channels that contain CACNA1D as pore-forming subunit. Regulates the activity of L-type calcium channels that contain CACNA1B as pore-forming subunit.
Target Subcellular Location
Cell membrane, sarcolemma; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein.
Target Protein Families
Calcium channel beta subunit family
Target Tissue Specificity
Detected in heart ventricle (at protein level). Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
Target Synonyms
CAB1; CACB1_HUMAN; CACNB1; CACNLB1; Calcium channel L type beta 1 polypeptide; Calcium channel voltage dependent beta 1 subunit; Calcium channel voltage-dependent subunit beta 1; CCHLB1; Dihydropyridine sensitive L type calcium channel beta 1 subunit; MGC41896; Voltage dependent L type calcium channel beta 1 subunit; Voltage-dependent L-type calcium channel subunit beta-1
Target Background
The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
