Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IER5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human IER5 (NP_057629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IER5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human IER5 (NP_057629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02402A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IER5 |
| Target Synonyms | SBBI48; IER5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse testis, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human IER5 (NP_057629.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APQPAEDEPPAPPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPE | Uniprot ID | Q5VY09 |
Uniprot Id
Q5VY09
Target Species
Human
Target Name
IER5
Target Full Name
Immediate early response gene 5 protein
Target Function
Plays a role as a transcription factor. Mediates positive transcriptional regulation of several chaperone genes during the heat shock response in a HSF1-dependent manner. Mediates negative transcriptional regulation of CDC25B expression. Plays a role in the dephosphorylation of the heat shock factor HSF1 and ribosomal protein S6 kinase (S6K) by the protein phosphatase PP2A. Involved in the regulation of cell proliferation and resistance to thermal stress. Involved in the cell cycle checkpoint and survival in response to ionizing radiation. Associates with chromatin to the CDC25B promoter.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
IER family
Target Tissue Specificity
Expressed in acute myeloid leukemia (AML) cells.
Target Synonyms
IER5; PP4583; SBBI48; Immediate early response gene 5 protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
