-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C1GALT1C1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C1GALT1C1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02414A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C1GALT1C1 |
| Target Synonyms | TNPS; COSMC; MST143; C1GALT2; HSPC067; C38H2-L1; C1GALT1C1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLS | Uniprot ID | Q96EU7 |
Uniprot Id
Q96EU7
Target Species
Human
Target Name
C1GALT1C1
Target Full Name
C1GALT1-specific chaperone 1
Target Function
Probable chaperone required for the generation of 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1).
Target Involvement
Tn polyagglutination syndrome (TNPS)
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 31 family, Beta3-Gal-T subfamily
Target Tissue Specificity
Ubiquitously expressed. Abundantly expressed in salivary gland, stomach, small intestine, kidney, and testis and at intermediate levels in whole brain, cerebellum, spinal cord, thymus, spleen, trachea, lung, pancreas, ovary, and uterus.
Target Synonyms
HSPC067; 3-galactosyltransferase 2; Beta 1,3 galactosyltransferase 2 ; Beta1,3 galactosyltransferase 2 ; C1Gal T2 ; C1Gal-T2; C1GALT1 specific chaperone 1 ; C1GALT1-specific chaperone 1; C1galt1c1; C1GalT2; C1GLC_HUMAN; C38H2 L1; C38H2 like protein 1; C38H2-L1; C38H2-like protein 1; C38H2L1; Core 1 beta1; Core 1 beta3 galactosyltransferase specific molecular chaperone; Core 1 beta3-Gal-T2; Core 1 beta3-galactosyltransferase-specific molecular chaperone; Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1,3 galactosyltransferase 2 ; COSMC ; MGC19947; MST143
Target Background
This gene encodes a type II transmembrane protein that is similar to the core 1 beta1, 3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lacks the galactosyltransferase activity itself, but instead acts as a molecular chaperone required for the folding, stability and full activity of the core 1 beta1, 3-galactosyltransferase 1. Mutations in this gene have been associated with Tn syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
Notification