Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TXNL4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human TXNL4B (NP_060323.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TXNL4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human TXNL4B (NP_060323.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02676A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TXNL4B |
| Target Synonyms | DLP; Dim2; TXNL4B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human TXNL4B (NP_060323.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI | Uniprot ID | Q9NX01 |
Uniprot Id
Q9NX01
Target Species
Human
Target Name
TXNL4B
Target Full Name
Thioredoxin-like protein 4B
Target Function
Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
Target Subcellular Location
Nucleus.
Target Protein Families
DIM1 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AI595343; D530025J19Rik; Dim1 like protein; Dim1-like protein; DIM2; DLP; FLJ20511; MGC109322; RGD1305127; Thioredoxin like 4B; Thioredoxin like protein 4B; Thioredoxin-like protein 4B; TXN4B_HUMAN; Txnl4b
Target Background
Predicted to be involved in mRNA splicing, via spliceosome. Located in cytosol and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
