-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-205 of human HOXA1 (NP_005513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-205 of human HOXA1 (NP_005513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02789A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXA1 |
| Target Synonyms | BSAS; HOX1; HOX1F; HOXA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, DU145, HT-1080 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-205 of human HOXA1 (NP_005513.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTF | Uniprot ID | P49639 |
Uniprot Id
P49639
Target Species
Human
Target Name
HOXA1
Target Full Name
Homeobox protein Hox-A1
Target Function
Sequence-specific transcription factor. Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior. Also part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments. Activates transcription in the presence of PBX1A and PKNOX1.
Target Involvement
Athabaskan brainstem dysgenesis syndrome (ABDS); Bosley-Salih-Alorainy syndrome (BSAS)
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family, Labial subfamily
Target Synonyms
BSAS; Homeo box A1; Homeobox 1F; Homeobox A1; Homeobox protein Hox A1; Homeobox protein Hox-1F; Homeobox protein Hox-A1; Hox 1.6 like protein; Hox 1F; HOX A1; HOX A1 homeodomain protein; HOX1; HOX1F; hoxa1; hoxb1b; HXA1_HUMAN; Lab like protein; MGC45232
Target Background
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region.
Notification