Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human ZNRD1 (NP_055411.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human ZNRD1 (NP_055411.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03421A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNRD1 |
| Target Synonyms | TEX6; ZR14; A12.2; HTEX6; Rpa12; ZNRD1; hZR14; HTEX-6; TCTEX6; tctex-6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human ZNRD1 (NP_055411.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS | Uniprot ID | Q9P1U0 |
Uniprot Id
Q9P1U0
Target Species
Human
Target Name
POLR1H
Target Full Name
DNA-directed RNA polymerase I subunit RPA12
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Target Research Area
Transcription
Target Synonyms
DNA directed RNA polymerase I subunit RPA12; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RNA polymerase I small specific subunit Rpa12; RPA12; RPA12_HUMAN; tctex 6; TCTEX6; TEX6; Transcription associated zinc ribbon protein; Zinc ribbon domain containing 1; Zinc ribbon domain containing protein 1; Zinc ribbon domain-containing protein 1; ZNRD1; ZR14
Target Background
This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
