-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-120 of human USP6 (NP_004496.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-120 of human USP6 (NP_004496.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03550A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP6 |
| Target Synonyms | HRP1; TRE2; TRE17; Tre-2; TRESMCR; USP6-short; USP6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-120 of human USP6 (NP_004496.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIK | Uniprot ID | P35125 |
Uniprot Id
P35125
Target Species
Human
Target Name
USP6
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 6
Target Function
Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation.
Target Involvement
A chromosomal aberration involving USP6 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with CDH11. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation (PubMed:15026324).
Target Subcellular Location
Cell membrane. Cytoplasm. Endosome. Note=Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Testis specific. Expressed in various cancer cell lines.
Target Research Area
Cell Biology
Target Synonyms
Deubiquitinating enzyme 6; HRP1; Proto-oncogene TRE-2; TRE17; TRE2; Ubiquitin carboxyl-terminal hydrolase 6; Ubiquitin specific protease 6; Ubiquitin thiolesterase 6; Ubiquitin-specific-processing protease 6; UBP6_HUMAN; USP6
Target Background
Enables thiol-dependent deubiquitinase. Involved in protein deubiquitination and regulation of vesicle-mediated transport. Located in plasma membrane and recycling endosome.
Notification