Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CPA1 (NP_001859.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CPA1 (NP_001859.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04062A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPA1 |
| Target Synonyms | CPA; CPA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse pancreas, Mouse spleen, Rat pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CPA1 (NP_001859.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEE | Uniprot ID | P15085 |
Uniprot Id
P15085
Target Species
Human
Target Name
CPA1
Target Full Name
Carboxypeptidase A1
Target Function
Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase M14 family
Target Synonyms
carboxypeptidase A1 (pancreatic); Carboxypeptidase A1; Carboxypeptidase A1 precursor; CBPA1_HUMAN; CPA; CPA1; Pancreatic carboxypeptidase A1; Procarboxypeptidase A1 pancreatic
Target Background
This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
