Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RCBTB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-551 of human RCBTB2 (NP_001259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RCBTB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-551 of human RCBTB2 (NP_001259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04067A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RCBTB2 |
| Target Synonyms | RLG; CHC1L; RCBTB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, MCF7, Mouse pancreas, Rat thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 362-551 of human RCBTB2 (NP_001259.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN | Uniprot ID | O95199 |
Uniprot Id
O95199
Target Species
Human
Target Name
RCBTB2
Target Full Name
RCC1 and BTB domain-containing protein 2
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome.
Target Synonyms
CHC1 L; CHC1L; Chromosome condensation 1 like; RCBT2; RCBT2_HUMAN; Rcbtb2; RCC1 and BTB domain containing protein 2; RCC1 and BTB domain-containing protein 2; RCC1 like G exchanging factor; RCC1 like G exchanging factor RLG; Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2; Regulator of chromosome condensation (RCC1) and BTB domain containing protein 2; Regulator of chromosome condensation and BTB domain containing protein 2; RLG
Target Background
This gene encodes a protein containing two C-terminal BTB/POZ domains that is related to regulator of chromosome condensation (RCC). The encoded protein may act as a guanine nucleotide exchange factor. This gene is observed to be lost or underexpressed in prostate cancers. There is a pseudogene of this gene on chromosome 10. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
