-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENPP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ENPP7 (Q6UWV6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENPP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ENPP7 (Q6UWV6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04239A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENPP7 |
| Target Synonyms | NPP7; NPP-7; E-NPP 7; ALK-SMase; ENPP7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ENPP7 (Q6UWV6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNN | Uniprot ID | Q6UWV6 |
Uniprot Id
Q6UWV6
Target Species
Human
Target Name
ENPP7
Target Full Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 7
Target Function
Choline-specific phosphodiesterase that hydrolyzes sphingomyelin releasing the ceramide and phosphocholine and therefore is involved in sphingomyelin digestion, ceramide formation, and fatty acid (FA) absorption in the gastrointestinal tract. Has also phospholipase C activity and can also cleave phosphocholine from palmitoyl lyso-phosphatidylcholine and platelet-activating factor (PAF) leading to its inactivation. Does not have nucleotide pyrophosphatase activity. May promote cholesterol absorption by affecting the levels of sphingomyelin derived from either diet or endogenous sources, in the intestinal lumen.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Target Tissue Specificity
Detected in the colon (at protein level). Expressed in the duodenum, jejunum and liver and at low levels in the ileum. Expression was very low in the esophagus, stomach and colon.
Target Synonyms
ENPP7; UNQ3077/PRO9912; Ectonucleotide pyrophosphatase/phosphodiesterase family member 7; E-NPP 7; NPP-7; Alkaline sphingomyelin phosphodiesterase; Intestinal alkaline sphingomyelinase; Alk-SMase
Target Background
The protein encoded by this gene is an intestinal alkaline sphingomyelin phosphodiesterase that converts sphingomyelin to ceramide and phosphocholine. The encoded protein is anchored in the cell membrane, and it may function to protect the intestinal mucosa from inflammation and tumorigenesis. This protein is glycosylated and also exhibits lysophosphatidylcholine hydrolase activity.
Notification