-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCTN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 945-1139 of human DCTN1 (NP_001128513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against DCTN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 945-1139 of human DCTN1 (NP_001128513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-04505A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCTN1 |
| Target Synonyms | P135; DP-150; DAP-150; DCTN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HepG2, Jurkat, Mouse testis, Rat testis, U-251MG | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 945-1139 of human DCTN1 (NP_001128513.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS | Uniprot ID | Q14203 |
Uniprot Id
Q14203
Target Species
Human
Target Name
DCTN1
Target Full Name
Dynactin subunit 1
Target Function
Plays a key role in dynein-mediated retrograde transport of vesicles and organelles along microtubules by recruiting and tethering dynein to microtubules. Binds to both dynein and microtubules providing a link between specific cargos, microtubules and dynein. Essential for targeting dynein to microtubule plus ends, recruiting dynein to membranous cargos and enhancing dynein processivity (the ability to move along a microtubule for a long distance without falling off the track). Can also act as a brake to slow the dynein motor during motility along the microtubule. Can regulate microtubule stability by promoting microtubule formation, nucleation and polymerization and by inhibiting microtubule catastrophe in neurons. Inhibits microtubule catastrophe by binding both to microtubules and to tubulin, leading to enhanced microtubule stability along the axon. Plays a role in metaphase spindle orientation. Plays a role in centriole cohesion and subdistal appendage organization and function. Its recruitment to the centriole in a KIF3A-dependent manner is essential for the maintenance of centriole cohesion and the formation of subdistal appendage. Also required for microtubule anchoring at the mother centriole. Plays a role in primary cilia formation.
Target Involvement
Neuronopathy, distal hereditary motor, 7B (HMN7B); Amyotrophic lateral sclerosis (ALS); Perry syndrome (PERRYS)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, spindle. Nucleus envelope. Cytoplasm, cell cortex.
Target Protein Families
Dynactin 150 kDa subunit family
Target Tissue Specificity
Brain.
Target Research Area
Cell Biology
Target Synonyms
150 kDa dynein associated polypeptide; 150 kDa dynein-associated polypeptide; DAP 150; DAP-150; DAP150; DCTN 1; DCTN1; DCTN1_HUMAN; DP 150; DP-150; DP150; Dynactin 1 (p150 Glued (Drosophila) homolog); Dynactin 1 (p150 glued homolog Drosophila); Dynactin 1; Dynactin subunit 1; Dynactin1; HMN7B; p135; p150 Glued (Drosophila) homolog ; p150 glued; p150 glued homolog; p150(GLUED) DROSOPHILA HOMOLOG OF; p150-glued; p150glued
Target Background
This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA).
Notification