-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ABI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04645A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABI1 |
| Target Synonyms | E3B1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1; ABI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Neuro-2a | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQR | Uniprot ID | Q8IZP0 |
Uniprot Id
Q8IZP0
Target Species
Human
Target Name
ABI1
Target Full Name
Abl interactor 1
Target Function
May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level. In brain, seems to regulate the dendritic outgrowth and branching as well as to determine the shape and number of synaptic contacts of developing neurons.
Target Involvement
A chromosomal aberration involving ABI1 is a cause of acute leukemias. Translocation t(10;11)(p11.2;q23) with KMT2A/MLL1. ABI1 isoform 2 was found to be present in acute leukemia KMT2A/MLL1-ABI1 fusion transcript.
Target Subcellular Location
Cytoplasm. Nucleus. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, growth cone. Cell junction, synapse, postsynaptic density. Cytoplasm, cytoskeleton.
Target Protein Families
ABI family
Target Tissue Specificity
Widely expressed, with highest expression in brain.
Target Synonyms
Abelson interactor 1; Abi-1; Abi1; ABI1_HUMAN; Abl binding protein 4; Abl interactor 1; Abl interactor protein 1; Abl-binding protein 4; AblBP4; e3B1; Eps8 binding protein; Eps8 SH3 domain binding protein; Eps8 SH3 domain-binding protein; Eps8-binding protein; Hssh3bp1; Interactor protein AblBP4; NAP1; Nap1 binding protein; Nap1-binding protein; Nap1BP; Spectrin SH3 domain binding protein 1; Spectrin SH3 domain-binding protein 1; SSH3BP
Target Background
This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14.
Notification