-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RFX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RFX1 (NP_002909.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RFX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RFX1 (NP_002909.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04659A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RFX1 |
| Target Synonyms | EFC; RFX; RFX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RFX1 (NP_002909.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPHVYSSQVQYVEG | Uniprot ID | P22670 |
Uniprot Id
P22670
Target Species
Human
Target Name
RFX1
Target Full Name
MHC class II regulatory factor RFX1
Target Function
Regulatory factor essential for MHC class II genes expression. Binds to the X boxes of MHC class II genes. Also binds to an inverted repeat (ENH1) required for hepatitis B virus genes expression and to the most upstream element (alpha) of the RPL30 promoter.
Target Subcellular Location
Nucleus.
Target Protein Families
RFX family
Target Synonyms
AI047719; AI385641; EF-C; EFC; Enhancer factor C; MHC class II regulatory factor RFX; MHC class II regulatory factor RFX1; Regulatory factor X 1; Regulatory factor X, 1 (influences HLA class II expression); Regulatory factor X1 ; RFX; RFX-1; Rfx1; RFX1_HUMAN; Trans-acting regulatory factor 1; Transcription factor RFX1
Target Background
This gene encodes a member of the regulatory factor X (RFX) family of transcription factors, which are characterized by a winged-helix DNA-binding domain. The encoded transcription factor contains an N-terminal activation domain and a C-terminal repression domain, and may activate or repress target gene expression depending on cellular context. This transcription factor has been shown to regulate a wide variety of genes involved in immunity and cancer, including the MHC class II genes and genes that may be involved in cancer progression. This gene exhibits altered expression in glioblastoma and the autoimmune disease systemic lupus erythematosis (SLE).
Notification