Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PACSIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human PACSIN1 (NP_065855.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PACSIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human PACSIN1 (NP_065855.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04807A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PACSIN1 |
| Target Synonyms | SDPI; PACSIN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human PACSIN1 (NP_065855.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRV | Uniprot ID | Q9BY11 |
Uniprot Id
Q9BY11
Target Species
Human
Target Name
PACSIN1
Target Full Name
Protein kinase C and casein kinase substrate in neurons protein 1
Target Function
Plays a role in the reorganization of the microtubule cytoskeleton via its interaction with MAPT; this decreases microtubule stability and inhibits MAPT-induced microtubule polymerization. Plays a role in cellular transport processes by recruiting DNM1, DNM2 and DNM3 to membranes. Plays a role in the reorganization of the actin cytoskeleton and in neuron morphogenesis via its interaction with COBL and WASL, and by recruiting COBL to the cell cortex. Plays a role in the regulation of neurite formation, neurite branching and the regulation of neurite length. Required for normal synaptic vesicle endocytosis; this process retrieves previously released neurotransmitters to accommodate multiple cycles of neurotransmission. Required for normal excitatory and inhibitory synaptic transmission. Binds to membranes via its F-BAR domain and mediates membrane tubulation.
Target Subcellular Location
Cytoplasm. Cell projection. Cell junction, synapse, synaptosome. Cell projection, ruffle membrane. Membrane; Peripheral membrane protein. Cytoplasmic vesicle membrane; Peripheral membrane protein. Cell junction, synapse. Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
PACSIN family
Target Tissue Specificity
Highly expressed in brain and, at much lower levels, in heart and pancreas.
Target Synonyms
A830061D09Rik; Dynamin PRD-interacting protein; Dynamin proline-rich domain-interacting protein; H74; KIAA1379; MGC114042; MGC56324; mKIAA1379; OTTHUMP00000016231 ; PACN1_HUMAN; Pacsin1; PASCIN; Protein kinase C and casein kinase substrate in neurons 1; Protein kinase C and casein kinase substrate in neurons protein 1; SDPI; Synaptic, dynamin-associated protein I; Syndapin 1; Syndapin; Syndapin-I; zgc:114042; zgc:56324
Target Background
Enables phospholipid binding activity. Involved in plasma membrane tubulation. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
