-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHKG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-350 of human PHKG1 (NP_006204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHKG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-350 of human PHKG1 (NP_006204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04896A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHKG1 |
| Target Synonyms | PHKG; PHKG1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 245-350 of human PHKG1 (NP_006204.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY | Uniprot ID | Q16816 |
Uniprot Id
Q16816
Target Species
Human
Target Name
PHKG1
Target Full Name
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
Target Function
Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase. In vitro, phosphorylates PYGM, TNNI3, MAPT/TAU, GAP43 and NRGN/RC3.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Synonyms
PHK gamma M; PHK-gamma-M; Phkg; PHKG1; PHKG1_HUMAN; PHKIN01; Phosphorylase b kinase gamma catalytic chain; Phosphorylase b kinase gamma catalytic chain skeletal muscle/heart isoform; phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform ; phosphorylase kinase gamma ; phosphorylase kinase subunit gamma 1 ; Phosphorylase kinase subunit gamma-1; phosphorylase kinase, gamma 1 (muscle); Phosphorylase kinase, muscle, gamma-1; Serine/threonine-protein kinase PHKG1; skeletal muscle/heart isoform
Target Background
This gene is a member of the Ser/Thr protein kinase family and encodes a protein with one protein kinase domain and two calmodulin-binding domains. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. This gene has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification