-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human FUT1 (NP_000139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human FUT1 (NP_000139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04951A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUT1 |
| Target Synonyms | H; HH; HSC; FUT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human FUT1 (NP_000139.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTF | Uniprot ID | P19526 |
Uniprot Id
P19526
Target Species
Human
Target Name
FUT1
Target Full Name
Galactoside alpha-(1,2)-fucosyltransferase 1
Target Function
Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the terminal galactose residue of glycoconjugates through an alpha(1,2) linkage leading to H antigen synthesis that is an intermediate substrate in the synthesis of ABO blood group antigens. H antigen is essential for maturation of the glomerular layer of the main olfactory bulb, in cell migration and early cell-cell contacts during tumor associated angiogenesis. Preferentially fucosylates soluble lactose and to a lesser extent fucosylates glycolipids gangliosides GA1 and GM1a.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 11 family
Target Synonyms
FUT1; H; HSC; Galactoside alpha-(1,2-fucosyltransferase 1; Alpha(1,2FT 1; Blood group H alpha 2-fucosyltransferase; Fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; Type 1 galactoside alpha-(1,2-fucosyltransferase FUT1; Type 2 galactoside alpha-(1,2-fucosyltransferase FUT1
Target Background
This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Notification