-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPPL2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SPPL2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04983A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPPL2A |
| Target Synonyms | IMP3; PSL2; IMD86; SPPL2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Rat small intestine | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ | Uniprot ID | Q8TCT8 |
Uniprot Id
Q8TCT8
Target Species
Human
Target Name
SPPL2A
Target Full Name
Signal peptide peptidase-like 2A
Target Function
Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane. Functions in FASLG, ITM2B and TNF processing. Catalyzes the intramembrane cleavage of the anchored fragment of shed TNF-alpha (TNF), which promotes the release of the intracellular domain (ICD) for signaling to the nucleus. Also responsible for the intramembrane cleavage of Fas antigen ligand FASLG, which promotes the release of the intracellular FasL domain (FasL ICD). May play a role in the regulation of innate and adaptive immunity. Catalyzes the intramembrane cleavage of the simian foamy virus envelope glycoprotein gp130 independently of prior ectodomain shedding by furin or furin-like proprotein convertase (PC)-mediated cleavage proteolysis.
Target Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein; Lumenal side. Note=Colocalizes with palmitoylated and myristoylated proteins at the plasma membrane.
Target Protein Families
Peptidase A22B family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
SPPL2A; IMP3; PSL2; PSEC0147; Signal peptide peptidase-like 2A; SPP-like 2A; SPPL2a; EC 3.4.23.-; Intramembrane protease 3; IMP-3; Presenilin-like protein 2
Target Background
This gene encodes a member of the GXGD family of aspartic proteases, which are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions, as well as a member of the signal peptide peptidase-like protease (SPPL) family. This protein is expressed in all major adult human tissues and localizes to late endosomal compartments and lysosomal membranes. A pseudogene of this gene also lies on chromosome 15.
Notification