Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BTF3 (NP_001198.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BTF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BTF3 (NP_001198.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05180A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTF3 |
| Target Synonyms | NACB; BTF3a; BTF3b; BETA-NAC; BTF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293F, PC-12, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BTF3 (NP_001198.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLV | Uniprot ID | P20290 |
Uniprot Id
P20290
Target Species
Human
Target Name
BTF3
Target Full Name
Transcription factor BTF3
Target Function
When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Target Subcellular Location
Cytoplasm. Nucleus. Note=The heterodimer with NACA is cytoplasmic.
Target Protein Families
NAC-beta family
Target Research Area
Transcription
Target Synonyms
Basic transcription factor 3; BETA NAC; BTF 3; btf3; BTF3_HUMAN; BTF3a; BTF3b; NACB; Nascent polypeptide associated complex beta polypeptide; RNA polymerase B transcription factor 3; Transcription factor BTF3
Target Background
This gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
