-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JAM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAM3 (NP_116190.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against JAM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAM3 (NP_116190.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05358A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JAM3 |
| Target Synonyms | JAMC; JAM-2; JAM-3; JAM-C; JAM3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAM3 (NP_116190.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSL | Uniprot ID | Q9BX67 |
Uniprot Id
Q9BX67
Target Species
Human
Target Name
JAM3
Target Full Name
Junctional adhesion molecule C
Target Function
Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN). Plays a role in angiogenesis. Plays a role in the regulation of cell migration (Probable). During myogenesis, it is involved in myocyte fusion.; Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.
Target Involvement
Hemorrhagic destruction of the brain with subependymal calcification and cataracts (HDBSCC)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction. Cell junction, desmosome. Cell junction, tight junction.; [Soluble form of JAM-C]: Secreted.
Target Protein Families
Immunoglobulin superfamily
Target Tissue Specificity
Detected on round and elongated spermatids (at protein level). Highest expression in placenta, brain and kidney. Significant expression is detected on platelets. Expressed in intestinal mucosa cells. Expressed in the vascular endothelium. Found in serum (
Target Synonyms
FLJ14529; JAM 2 ; JAM 3; JAM C; JAM-2; JAM-3; JAM-C; JAM2 ; Jam3; JAM3_HUMAN; JAMC; Junctional adhesion molecule 3; Junctional adhesion molecule 3 precursor; Junctional adhesion molecule C
Target Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.
Notification