-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKIRAS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NKIRAS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05401A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NKIRAS1 |
| Target Synonyms | KBRAS1; kappaB-Ras1; NKIRAS1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN | Uniprot ID | Q9NYS0 |
Uniprot Id
Q9NYS0
Target Species
Human
Target Name
NKIRAS1
Target Full Name
NF-kappa-B inhibitor-interacting Ras-like protein 1
Target Function
Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Small GTPase superfamily, Ras family, KappaB-Ras subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
2400004O09Rik ; I kappa B interacting Ras like protein 1; I-kappa-B-interacting Ras-like protein 1; Kappa B Ras 1; Kappa B Ras protein 1; Kappa B-Ras protein 1; KappaB Ras1; KappaB-Ras1; KBRAS 1; KBRAS1; KBRS1_HUMAN; NF kappa B inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; NFKB inhibitor interacting Ras like 1; NFKB inhibitor interacting Ras like protein 1; NKIRAS 1; nkiras1
Target Background
Predicted to enable GTPase activating protein binding activity. Predicted to be involved in I-kappaB kinase/NF-kappaB signaling. Predicted to act upstream of or within several processes, including Ral protein signal transduction; lung alveolus development; and surfactant homeostasis. Located in cytosol and endoplasmic reticulum.
Notification