-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UNC5C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human UNC5C (NP_003719.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UNC5C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human UNC5C (NP_003719.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05441A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UNC5C |
| Target Synonyms | UNC5H3; UNC5C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse lung, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human UNC5C (NP_003719.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK | Uniprot ID | O95185 |
Uniprot Id
O95185
Target Species
Human
Target Name
UNC5C
Target Full Name
Netrin receptor UNC5C
Target Function
Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. NTN1/Netrin-1 binding might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion. Axon repulsion in growth cones may also be caused by its association with DCC that may trigger signaling for repulsion. Might also collaborate with DSCAM in NTN1-mediated axon repulsion independently of DCC. Also involved in corticospinal tract axon guidance independently of DCC. Involved in dorsal root ganglion axon projection towards the spinal cord. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface. Cell junction, synapse, synaptosome. Cell projection, axon. Cell projection, dendrite. Cell projection, growth cone. Cell projection, lamellipodium. Cell projection, filopodium.
Target Protein Families
Unc-5 family
Target Tissue Specificity
Mainly expressed in brain. Expressed in temporal lobe cortical neurons and in neurons of the hippocampal pyramidal layer. Also expressed in kidney. Not expressed in developing or adult lung.
Target Synonyms
homolog of C. elegans transmembrane receptor Unc5; Netrin receptor UNC5C; Protein unc 5 homolog C; Protein unc-5 homolog 3; Protein unc-5 homolog C; Unc 5 homolog 3; Unc 5 homolog C; Unc5 (C.elegans homolog) c; Unc5c; UNC5C_HUMAN; UNC5H3
Target Background
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Notification