-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BANF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BANF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05573A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BANF1 |
| Target Synonyms | BAF; NGPS; BCRP1; D14S1460; BANF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse thymus, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL | Uniprot ID | O75531 |
Uniprot Id
O75531
Target Species
Human
Target Name
BANF1
Target Full Name
Barrier-to-autointegration factor
Target Function
Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.; (Microbial infection) Exploited by retroviruses for inhibiting self-destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD.; (Microbial infection) In case of poxvirus infection, has an antiviral activity by blocking viral DNA replication.
Target Involvement
Nestor-Guillermo progeria syndrome (NGPS)
Target Subcellular Location
[Barrier-to-autointegration factor]: Nucleus. Cytoplasm. Chromosome. Nucleus envelope.
Target Protein Families
BAF family
Target Tissue Specificity
Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes.
Target Synonyms
BAF; BAF_HUMAN; BANF 1; BANF1; Barrier to autointegration factor 1; Barrier to autointegration factor; Barrier-to-autointegration factor; BCRG 1; BCRG1; BCRP 1; BCRP1; Breakpoint cluster region protein 1; D14S1460; MGC111161; NGPS
Target Background
The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.
Notification