-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMYD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SMYD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05592A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMYD3 |
| Target Synonyms | KMT3E; ZMYND1; ZNFN3A1; bA74P14.1; SMYD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HepG2, HT-29, MCF7, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT | Uniprot ID | Q9H7B4 |
Uniprot Id
Q9H7B4
Target Species
Human
Target Name
SMYD3
Target Full Name
Histone-lysine N-methyltransferase SMYD3
Target Function
Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but not monomethylation. Also methylates 'Lys-5' of histone H4. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family
Target Tissue Specificity
Expressed in skeletal muscles and testis. Overexpressed in a majority of colorectal and hepatocellular carcinomas.
Target Research Area
Cancer
Target Synonyms
bA74P14.1 (novel protein); bA74P14.1; FLJ21080; histone lysine N methyltransferase SMYD3; KMT3E; MGC104324; SET and MYND domain containing 3; SET and MYND domain containing protein 3; SET and MYND domain-containing protein 3; SMYD 3; Smyd3; SMYD3 protein; SMYD3_HUMAN; Zinc finger MYND domain containing 1; Zinc finger MYND domain containing protein 1; Zinc finger MYND domain-containing protein 1; Zinc finger protein subfamily 3A MYND domain containing 1; Zinc finger protein, subfamily 3A (MYND domain containing), 1; ZMYND 1; ZMYND1; ZNFN3A1
Target Background
This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification