Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZSCAN20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ZSCAN20 (NP_660281.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZSCAN20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ZSCAN20 (NP_660281.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05678A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZSCAN20 |
| Target Synonyms | KOX29; ZNF31; ZFP-31; ZNF360; ZSCAN20 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse brain, Mouse thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ZSCAN20 (NP_660281.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEASRQRFRQFQYRDAAGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGEEAVALVEDWHRETRTAGQSGLELHTEETRPLKTGEEAQSFQLQPVDPWPEGQSQKKGVKNTCPDLPNHLNAEVAPQPLKE | Uniprot ID | P17040 |
Uniprot Id
P17040
Target Species
Human
Target Name
ZSCAN20
Target Full Name
Zinc finger and SCAN domain-containing protein 20
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Research Area
Transcription
Target Synonyms
ZSCAN20; KOX29; ZNF31; ZNF360; Zinc finger and SCAN domain-containing protein 20; Zinc finger protein 31; Zinc finger protein 360; Zinc finger protein KOX29
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
