Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 225-284 of human IDI1 (NP_004499.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IDI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 225-284 of human IDI1 (NP_004499.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06008A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDI1 |
| Target Synonyms | IPP1; IPPI1; IDI1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A431, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 225-284 of human IDI1 (NP_004499.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM | Uniprot ID | Q13907 |
Uniprot Id
Q13907
Target Species
Human
Target Name
IDI1
Target Full Name
Isopentenyl-diphosphate Delta-isomerase 1
Target Function
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Target Subcellular Location
Peroxisome.
Target Protein Families
IPP isomerase type 1 family
Target Synonyms
isopentenyl diphosphate dimethylallyl diphosphate isomerase; IDI1; IDI1_HUMAN; IPP isomerase 1; IPP isomerase; IPPI1; Isopentenyl diphosphate Delta isomerase 1; Isopentenyl diphosphate Delta isomerase; isopentenyl diphosphate dimethylallyl diphosphate isomerase 1 ; Isopentenyl pyrophosphate isomerase 1; Isopentenyl-diphosphate Delta-isomerase 1; OTTHUMP00000018951
Target Background
IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
