Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CABP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CABP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06101A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CABP7 |
| Target Synonyms | CALN2; CABP7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Mouse lung, Rat kidney, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI | Uniprot ID | Q86V35 |
Uniprot Id
Q86V35
Target Species
Human
Target Name
CABP7
Target Full Name
Calcium-binding protein 7
Target Function
Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity.
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Cytoplasm, perinuclear region. Cell membrane; Single-pass type IV membrane protein.
Target Synonyms
CaBP7; CABP7_HUMAN; Calcium binding protein CaBP7; Calcium-binding protein 7; CALN2; Calneuron 2; Calneuron II; Calneuron-2; MGC129428; MGC129429; MGC57793; MGC94082; OTTMUSP00000005262; rCaBP7; RP23-280J3.1
Target Background
Predicted to enable calcium ion binding activity. Located in trans-Golgi network membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
