-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS6KA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 673-772 of human RPS6KA4 (NP_003933.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RPS6KA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 673-772 of human RPS6KA4 (NP_003933.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06474A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS6KA4 |
| Target Synonyms | MSK2; RSK-B; S6K-alpha-4; RPS6KA4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 673-772 of human RPS6KA4 (NP_003933.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS | Uniprot ID | O75676 |
Uniprot Id
O75676
Target Species
Human
Target Name
RPS6KA4
Target Full Name
Ribosomal protein S6 kinase alpha-4
Target Function
Serine/threonine-protein kinase that is required for the mitogen or stress-induced phosphorylation of the transcription factors CREB1 and ATF1 and for the regulation of the transcription factor RELA, and that contributes to gene activation by histone phosphorylation and functions in the regulation of inflammatory genes. Phosphorylates CREB1 and ATF1 in response to mitogenic or stress stimuli such as UV-C irradiation, epidermal growth factor (EGF) and anisomycin. Plays an essential role in the control of RELA transcriptional activity in response to TNF. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14). In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines. Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Synonyms
90 kDa ribosomal protein S6 kinase 4; EC 2.7.11.1 ; KS6A4_HUMAN; Mitogen and stress activated protein kinase 2; Nuclear mitogen and stress activated protein kinase 2; Nuclear mitogen- and stress-activated protein kinase 2; Ribosomal protein kinase B; Ribosomal protein S6 kinase 90kD polypeptide 4; Ribosomal protein S6 kinase 90kDa polypeptide 4; Ribosomal protein S6 kinase alpha 4; Ribosomal protein S6 kinase alpha-4; RPS6KA4; RSKB; S6K-alpha-4
Target Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and ATF1. The encoded protein can also phosphorylate histone H3 to regulate certain inflammatory genes. Several transcript variants encoding different isoforms have been found for this gene.
Notification