Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human UBL5 (NP_077268.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human UBL5 (NP_077268.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06533A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBL5 |
| Target Synonyms | HUB1; UBL5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human UBL5 (NP_077268.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ | Uniprot ID | Q9BZL1 |
Uniprot Id
Q9BZL1
Target Species
Human
Target Name
UBL5
Target Full Name
Ubiquitin-like protein 5
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
Target Synonyms
FLJ46917; HUB1; MGC131795; Ubiquitin like 5; Ubiquitin like protein 5; Ubiquitin-like protein 5; Ubl5; UBL5_HUMAN
Target Background
This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
