-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRAS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NRAS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06821A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRAS |
| Target Synonyms | NS6; CMNS; KRAS; NCMS; ALPS4; N-ras; NRAS1; NRAS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM | Uniprot ID | P01111 |
Uniprot Id
P01111
Target Species
Human
Target Name
NRAS
Target Full Name
GTPase NRas
Target Function
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Target Involvement
Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 6 (NS6); RAS-associated autoimmune leukoproliferative disorder (RALD); Melanocytic nevus syndrome, congenital (CMNS); Melanosis, neurocutaneous (NCMS); Keratinocytic non-epidermolytic nevus (KNEN); Thyroid cancer, non-medullary, 2 (NMTC2)
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Ras family
Target Research Area
Cancer
Target Synonyms
ALPS4; AV095280; GTPase NRas; HRAS1; N ras; N ras protein part 4; Neuroblastoma RAS viral (v ras) oncogene homolog; NRAS; NRAS1; NS6; OTTHUMP00000013879; OTTMUSP00000023521; RASN_HUMAN; Transforming protein N Ras; Transforming protein N-Ras; v ras neuroblastoma RAS viral oncogene homolog
Target Background
This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia.
Notification