Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human HEBP1 (NP_057071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HEBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human HEBP1 (NP_057071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEBP1 |
| Target Synonyms | HBP; HEBP; HEBP1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse spleen, Rat liver, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human HEBP1 (NP_057071.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGY | Uniprot ID | Q9NRV9 |
Uniprot Id
Q9NRV9
Target Species
Human
Target Name
HEBP1
Target Full Name
Heme-binding protein 1
Target Function
May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities.
Target Subcellular Location
Cytoplasm.
Target Protein Families
HEBP family
Target Research Area
Cardiovascular
Target Synonyms
HBP; HEBP; Hebp1; HEBP1_HUMAN; Heme binding protein 1; Heme-binding protein 1; p22HBP
Target Background
The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
