Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OSBPL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OSBPL8 (NP_065892.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against OSBPL8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OSBPL8 (NP_065892.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07115A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OSBPL8 |
| Target Synonyms | ORP8; MST120; OSBP10; MSTP120; OSBPL8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse spleen, Rat kidney, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human OSBPL8 (NP_065892.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGGLADGEPDRTSLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSS | Uniprot ID | Q9BZF1 |
Uniprot Id
Q9BZF1
Target Species
Human
Target Name
OSBPL8
Target Full Name
Oxysterol-binding protein-related protein 8
Target Function
Lipid transporter involved in lipid countertransport between the endoplasmic reticulum and the plasma membrane: specifically exchanges phosphatidylserine with phosphatidylinositol 4-phosphate (PI4P), delivering phosphatidylserine to the plasma membrane in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum. Binds phosphatidylserine and PI4P in a mutually exclusive manner. Binds oxysterol, 25-hydroxycholesterol and cholesterol.
Target Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane.; [Isoform 3]: Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
OSBP family
Target Tissue Specificity
Widely expressed. Expressed at higher level in macrophages.
Target Synonyms
OSBPL8; KIAA1451; ORP8; OSBP10; Oxysterol-binding protein-related protein 8; ORP-8; OSBP-related protein 8
Target Background
This gene encodes a member of a family of proteins containing an N-terminal pleckstrin homology domain and a highly conserved C-terminal oxysterol-binding protein-like sterol-binding domain. It binds mutliple lipid-containing molecules, including phosphatidylserine, phosphatidylinositol 4-phosphate (PI4P) and oxysterol, and promotes their exchange between the endoplasmic reticulum and the plasma membrane. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
