Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 396-483 of human SRSF11 (NP_001177916) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SRSF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 396-483 of human SRSF11 (NP_001177916) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF11 |
| Target Synonyms | p54; NET2; SFRS11; dJ677H15.2; SRSF11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 396-483 of human SRSF11 (NP_001177916). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKKKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD | Uniprot ID | Q05519 |
Uniprot Id
Q05519
Target Species
Human
Target Name
SRSF11
Target Full Name
Serine/arginine-rich splicing factor 11
Target Function
May function in pre-mRNA splicing.
Target Subcellular Location
Nucleus. Note=Colocalizes with spliceosome components.
Target Protein Families
Splicing factor SR family
Target Synonyms
Arginine rich 54 kDa nuclear protein; Arginine-rich 54 kDa nuclear protein; arginine/serine-rich 11; dJ677H15.2; DKFZp686M13204; NET2; P54; Serine/arginine-rich splicing factor 11; SFR11; SFRS 11; Splicing factor; Splicing factor arginine/serine rich 11; Splicing factor p54; SRS11_HUMAN; SRSF11
Target Background
This gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing. Alternative splicing results in multiple transcript variants encoding different proteins. In addition, a pseudogene of this gene has been found on chromosome 12.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
